CHAPTER 2 - PROTEIN STRUCTURE

G:  PREDICTING PROTEIN PROPERTIES -  BIOINFORMATICS, COMPUTATIONAL BIOLOGY, AND PROTEOMICS

BIOCHEMISTRY - DR. JAKUBOWSKI

Last Update:  02/28/13

Learning Goals/Objectives for Chapter 2G:  After class and this reading, students will be able to:

  • find web based proteomics protein to analyze protein sequences and structures
  • describe the basis for methods used to predict the secondary structure and hydrophobic structures of proteins
  • analyze secondary structure and hydropathy plots from web-based proteomics programs.
  • describe differences between integral and peripheral membranes proteins, and how each could be purified.
  • explain how hydropathy and secondary structure plots can be used to predict membrane spanning sequences of proteins
  • describe in general the theoretical and empirically based methods to predict protein tertiary structure from a primary sequence
  • describe possible early intermediates in protein folding as determined by theoretical methods

Bioinformatics, Computational Biology and Proteomics

With the solving of the human genome, intensive effort has been devoted to analysis of the human genome to determine the number and transcriptional regulation of the encoded genes.  Much has been learned from comparative genomics, as genomes from mice, rats, chimpanzees, and a variety of prokaryotes are compared in an effort to help understand the nature of genes and their transcriptional regulation.  The vast amount of genomic data that has to be "mined" has required the development of computational and computer programs to enable the analysis.  Two relatively new fields have subsequently arisen:  bioinformatics and computational biology.  (In a personal note, the words computational biology seem somewhat restrictive since the field of computational chemistry, which has a longer history, has significant overlap with "computational biology".  I prefer computational biochemistry).  These fields have significant overlap (as do physical chemistry/chemical physics and biochemistry/molecular biology/chemical biology), so I defer to others to define them. 

The NIH Biomedical Information Science and Technology Initiative Consortium:   "This consortium has agreed on the following definitions of bioinformatics and computational biology, recognizing that no definition could completely eliminate overlap with other activities or preclude variations in interpretation by different individuals and organizations.

Bioinformatics: Research, development, or application of computational tools and approaches for expanding the use of biological, medical, behavioral or health data, including those to acquire, store, organize, archive, analyze, or visualize such data.

Computational Biology: The development and application of data-analytical and theoretical methods, mathematical modeling and computational simulation techniques to the study of biological, behavioral, and social systems."

The National Center for Biotechnology Information (NCBI 2001) offers this definition of bioinformatics:

bioinformatics: "Bioinformatics is the field of science in which biology, computer science, and information technology merge into a single discipline. There are three important sub-disciplines within bioinformatics: the development of new algorithms and statistics with which to assess relationships among members of large data sets; the analysis and interpretation of various types of data including nucleotide and amino acid sequences, protein domains, and protein structures; and the development and implementation of tools that enable efficient access and management of different types of information."

What comes after the solving of the genome?  The transcriptome, the complete set of transcribed RNA sequences and their biological functions, and the immensely complex proteome, the complete set of translated protein, are obvious candidates.    Here are some definitions of proteomics:

Proteomics:   "the qualitative and quantitative comparison of proteomes (PROTEin complement to a genOME) under different conditions to further unravel biological processes" from ExPASy (Expert Protein Analysis System) server of the Swiss Institute of Bioinformatics

Proteomics (Pasteur Institute):  "Proteomics aims at quantifying the expression levels of the complete protein complement (the proteome) in a cell at any given time. While proteomics research was initially focused on two-dimensional gel electrophoresis for protein separation and identification, proteomics now refers to any procedure that characterizes the function of large sets of proteins. It is thus often used as a synonym for functional genomics."

Richard Burgess, UW Madison, includes the following activities in proteomics: (C&E New, July 31, 2000, pg 31) , which will revolutionize our understanding of normal and disease processes in cells. 

  • High-throughput expression and purification of proteins
  • Protein profiling, using 2D gel electrophoresis and mass spectrometry to study proteins expressed in a cell
  • Protein-protein interaction studies to see which proteins function together using the yeast two hybrid method
  • Pathway analysis to understand signal transduction and other complex cell processes
  • Large scale protein folding and 3D structure studies
  • Bioinformatics analysis of proteomic data

This web book has been developed as a first semester biochemistry text.  I have made a conscious choice to limit the scope of the material to exclude content covered in detail in a molecular biology/genetics class.  Hence, this text will not discuss in significant detail the genome and transcriptome, and mechanisms of replication, transcription, or translation.   However, with its emphasis on protein structure and function, proteomics is a logical  candidate for inclusion.

In the last several years, computational biology/chemistry and web-based programs have become available for the systematic analysis of individual proteins, and for the comparative analysis of many proteins, based on either their DNA or amino acid sequence.  Clearly the ultimate goal in the description of a protein would be to determine, from the amino acid or nucleotide sequence, the three dimensional structure of a protein and its biological function, including all its binding partners.   Here is a list of typical properties of a protein that can be determined by input of an appropriate sequence (for a protein with known or unknown 3D structure) into web-based programs:

  • protein sequence from a DNA sequence, and the reverse

  • isoelectric point

  • Ramachandrian plot

  • glycosylation/phosphorylation sites

  • secondary structure prediction

  • hydrophobicity prediction

  • 3D structure based on structures of homology protein (homology modeling)

  • determination of evolutionary relationships among organisms.

Here is a list of proteome web resources and tutorials

Computational biochemistry programs (such as Insight II, MOE, SwissPdb Viewer, VMD, NAMD, Autodock) are available to calculate surface electrostatic potentials, minimize energy, dock ligand molecules, and perform molecular dynamics simulations.

The ExPASy (Expert Protein Analysis System) proteomics server of the Swiss Institute of Bioinformatics offers an incredible array of tools to study protein structure and function.  These include:

Voluminous databases of biomolecule sequence and structural data, as well as analysis software packages, are available at a variety of web sites, including:

The NCBI has an extensive array of available tools (free), including:

The table below (directly taken from Wikipedia) shows some of the incredible information available the proteome and genome of each human chromosome. 

Table:  Human proteome and genome from Wikipedia
(Data source: Ensembl genome browser release 68, July 2012)

Chromsome Length (mm) BP Variations Confirmed Proteins Putative Proteins Pseudogenes miRNA rRNA snRNA snoRNA misc ncRNA Links
1 85 249,250,621 4,401,091 2,012 31 1,130 134 66 221 145 106 EBI
2 83 243,199,373 4,607,702 1,203 50 948 115 40 161 117 93 EBI
3 67 198,022,430 3,894,345 1,040 25 719 99 29 138 87 77 EBI
4 65 191,154,276 3,673,892 718 39 698 92 24 120 56 71 EBI
5 62 180,915,260 3,436,667 849 24 676 83 25 106 61 68 EBI
6 58 171,115,067 3,360,890 1,002 39 731 81 26 111 73 67 EBI
7 54 159,138,663 3,045,992 866 34 803 90 24 90 76 70 EBI
8 50 146,364,022 2,890,692 659 39 568 80 28 86 52 42 EBI
9 48 141,213,431 2,581,827 785 15 714 69 19 66 51 55 EBI
10 46 135,534,747 2,609,802 745 18 500 64 32 87 56 56 EBI
11 46 135,006,516 2,607,254 1,258 48 775 63 24 74 76 53 EBI
12 45 133,851,895 2,482,194 1,003 47 582 72 27 106 62 69 EBI
13 39 115,169,878 1,814,242 318 8 323 42 16 45 34 36 EBI
14 36 107,349,540 1,712,799 601 50 472 92 10 65 97 46 EBI
15 35 102,531,392 1,577,346 562 43 473 78 13 63 136 39 EBI
16 31 90,354,753 1,747,136 805 65 429 52 32 53 58 34 EBI
17 28 81,195,210 1,491,841 1,158 44 300 61 15 80 71 46 EBI
18 27 78,077,248 1,448,602 268 20 59 32 13 51 36 25 EBI
19 20 59,128,983 1,171,356 1,399 26 181 110 13 29 31 15 EBI
20 21 63,025,520 1,206,753 533 13 213 57 15 46 37 34 EBI
21 16 48,129,895 787,784 225 8 150 16 5 21 19 8 EBI
22 17 51,304,566 745,778 431 21 308 31 5 23 23 23 EBI
X 53 155,270,560 2,174,952 815 23 780 128 22 85 64 52 EBI
Y 20 59,373,566 286,812 45 8 327 15 7 17 3 2 EBI
mtDNA 0.0054 16,569 929 13 0 0 0 2 0 0 22 EBI

This chapter will focus on predictions of secondary and tertiary structures of proteins based on computation biochemistry and bioinformatics.  Specific exercises (for those enrolled in the class) using web-based bioinformatics programs will be found in Laboratory and Problem Sets.  


Secondary Structure

As we have seen previously, amino acids vary in their propensity to be found in alpha helices, beta strands, or reverse turns (beta bends, beta turns).    These difference can be rationalized from the structure of each amino acid, as described before. 

Figure:  Amino Acid Structure and propensity for secondary structure

From the data bases, propensities can be calculated to determine the likelihood that a given amino acid will be in one of those structures. Glycine for example would have a high propensity to be in reverse turns, while Pro, a helix breaker,  would have a low propensity to be in an alpha helix.   A number is assigned to each amino acid for each category of secondary structure. High numbers favor the likelihood that that amino acid would be in that structure.  One of the earliest propensity scales was from Chou-Fasman, where H indicates high propensity for secondary structure, h intermediate propensity, i is inhibitory, b is a intermediate breaker, and  B is a significant breaker of secondary structure.  

Chou-Fasman Amino Acid Propensities

A.A. Helix Sheet
Designation P Designation P
Ala H 1.42 i 0.83
Cys i 0.70 h 1.19
Asp I 1.01 B 0.54
Glu H 1.51 B 0.37
Phe h 1.13 h 1.38
Gly B 0.57 b 0.75
His I 1.00 h 0.87
Ile h 1.08 H 1.60
Lys h 1.16 b 0.74
Leu H 1.21 h 1.30
Met H 1.45 h 1.05
Asn b 0.67 b 0.89
Pro B 0.57 B 0.55
Gln h 1.11 h 1.10
Arg i 0.98 i 0.93
Ser i 0.77 b 0.75
Thr i 0.83 h 1.19
Val h 1.06 H 1.70
Trp h 1.08 h 1.37
Tyr b 0.69 H 1.47

Next a stretch or "window" of amino acids about 7 amino acids is taken, starting from the N-terminal of the protein. First the average alpha helical propensities for amino acids 1-7 are determined and assigned, let's say, to the middle (4th) amino acid in that sequence. Then alpha helical propensities for amino acids 2-8  (the next window) are averaged and assigned to the middle (5) amino acid in that range. The window slide down the protein sequence until all but the first and last few amino acids have an average value assigned to them. If a contiguous stretch of amino acids has high average propensity, they are probably in an alpha helix in the native protein. This process is repeated using beta strand and reverse turn propensities. The final assignments of most probably secondary structure are made. Of course this system was tested against proteins whose tertiary structure was known. See the results for secondary structure prediction for one protein. In this example, the average propensity for four contiguous amino acids is calculated (starting with amino acids 1-4, then amino acids 5-8, etc, and continuing to the end of the polypeptide).  Next this process is repeated for contiguous stretches 2-5, 6-9, etc, and continuing to the end.  The original Chou Fasman propensities have been updated using known protein structure to give better predictions.

Amphiphilic Helices

Additional information about putative helices can be obtained by determining if they are amphiphilic (one side of the helix containing mostly hydrophobic side chains, with the opposite side containing polar or charged side chains.  A helical wheel projection can be made. In this a circle is draw representing a downward cross-sectional view of the helix axis.

Figure:  Helical wheel projection

The side chains are placed on the outside of the circle, staggered in a fashion determined by the fact that there are 3.6 amino acids per turn of the helix. If one side of the wheel contains predominantly nonpolar side chains while the other side has polar side chains, the helix is amphiphilic. Imagine how such helices might be packed in a protein.

Hydrophobic Structure

In a completely analogous fashion, a hydrophobic propensity or hydopathy can be calculated. In this system, empirical measures of the hydrophobic nature of the side chains are used to assign a number to a given amino acid. Many hydropathy scales are used. Several are based on the Dmo transfer of the side chains from water to a nonpolar solvent. Two commonly used scales are the Kyte-Doolittle Hydropathy and Hopp-Woods scales (used more like a hydrophilicity index to predict surface or water accessible structures that might be recognized by the immune system)

  Hydrophobicity Indices for Amino Acids

Amino Acid

 Kyte-Doolittle

 Hopp-Woods

Alanine

 1.8

 -0.5

Arginine

 -4.5

 3.0

Asparagine

 -3.5

 0.2

Aspartic acid

 -3.5

 3.0

Cysteine

 2.5

 -1.0

Glutamine

 -3.5

 0.2

Glutamic acid

 -3.5

 3.0

Glycine

 -0.4

 0.0

Histidine

 -3.2

 -0.5

Isoleucine

 4.5

 -1.8

Leucine

 3.8

 -1.8

Lysine

 -3.9

 3.0

Methionine

 1.9

 -1.3

Phenylalanine

 2.8

 -2.5

Proline

 -1.6

 0.0

Serine

 -0.8

 0.3

Threonine

 -0.7

 -0.4

Tryptophan

 -0.9

 -3.4

Tyrosine

 -1.3

 -2.3

Valine

 4.2

 -1.5

For a water-soluble protein, a  continuous stretch of amino acids found to have a high average hydropathy is probably buried in the interior of the protein.  Consider the example of bovine a-chymotrypsinogen, a 245 amino acid protein, whose sequence is shown below in single letter code.

1 CGVPAIQPVLSGLSRIVNGEEAVPGSWPWQVSLQDKTGFHFCGGSLINENWVVTAAHCGV
61 TTSDVVVAGEFDQGSSSEKIQKLKIAKVFKNSKYNSLTINNDITLLKLSTAASFSQTVSA
121 VCLPSASDDFAAGTTCVTTGWGLTRYTNANTPDRLQQASLPLLSNTNCKKYWGTKIKDAM
181 ICAGASGVSSCMGDSGGPLVCKKNGAWTLVGIVSWGSSTCSTSTPGVYARVTALVNWVQQ
241 TLAAN

A hydrophathy plot for chymotrypsinogen (sum of hydropathies of seven consecutive residues) shows many stretches that are presumably buried in the interior of the protein.

Figure:  hydrophathy plot for chymotrypsinogen

Membrane Proteins

So far we have discussed predominantly globular proteins that are soluble in water.  Proteins are also found associated with membranes.   Two major classes of membrane proteins are found in nature.

Figure:  Types of membrane proteins

In some of these integral membrane proteins, large extracellullar and intracellular domains of the protein are present, connected by the intramembrane regions. The intramembrane spanning region often consists of either a single alpha helix, or 7 different helical regions which zig-zag through the membrane. These  transmembrane sequences can readily be determined through hydropathy calculations.  For example, consider the integral membrane bovine protein rhodopsin.  Its 348 amino acid sequence  (in single letter code) is shown below:

MNGTEGPNFYVPFSNKTGVVRSPFEAPQYYLAEPWQFSMLAAYMFLLIMLGFPINFLTLY
VTVQHKKLRTPLNYILLNLAVADLFMVFGGFTTTLYTSLHGYFVFGPTGCNLEGFFATLG
GEIALWSLVVLAIERYVVVCKPMSNFRFGENHAIMGVAFTWVMALACAAPPLVGWSRYIP
EGMQCSCGIDYYTPHEETNNESFVIYMFVVHFIIPLIVIFFCYGQLVFTVKEAAAQQQES
ATTQKAEKEVTRMVIIMVIAFLICWLPYAGVAFYIFTHQGSDFGPIFMTIPAFFAKTSAV
YNPVIYIMMNKQFRNCMVTTLCCGKNPLGDDEASTTVSKTETSQVAPA

 Rhodopsin hydropathy plot calculations shows that is contains seven transmembrane helices which wind through the membrane in a serpentine fashion..  

Figure:   Rhodopsin hydropathy plot


Figure:  seven transmembrane helices


Rhodopsin Hydropathy Results

No. N terminal transmembrane region C terminal type length
1 40 LAAYMFLLIMLGFPINFLTLYVT 62 PRIMARY 23
2 71 PLNYILLNLAVADLFMVFGGFTT 93 SECONDARY 23
3 113 EGFFATLGGEIALWSLVVLAIER 135 SECONDARY 23
4 156 GVAFTWVMALACAAPPLVGWSRY 178 SECONDARY 23
5 207 MFVVHFIIPLIVIFFCYGQLVFT 229 PRIMARY 23
6 261 FLICWLPYAGVAFYIFTHQGSDF 283 PRIMARY 23
7 300 VYNPVIYIMMNKQFRNCMVTTLC 322 SECONDARY 23

In summary, hydropathy plots are hence useful in finding buried regions in water soluble proteins, transmembrane helices in integral membrane proteins as well as short stretches of polar/charged amino acids that might form surface loops recognizable by immune system antibodies.  The window size used in hydropathy plots would obviously affect the calculated results.  Windows of 20 amino acids are useful to determine transmembrane helices while windows of 5-7 amino acids are used to find surface-exposed hydrophilic sites.

Membrane proteins call be solubilized by addition of single chain amphiphiles (detergents).  The nonpolar tails of the detergents interact with the hydrophobic transmembrane domain of the membrane protein forming a "mixed" micelle-like structure.  Nonionic detergents like Triton X-100 and octyl-glucoside are often used to solubilize membrane proteins in their near native state.  In contrast, ionic detergents like sodium dedecyl sulfate (with a negatively charged head group) denature proteins during the solubilization process.  To study membrane proteins in a more native-like environment, proteins solubilized by nonionic detergent can be reconstituted into bilayer liposome structures using methods similar to those from Lab 1 in which you prepared dye-capsulated large unilamellar vesicles (LUVs).  However, it can be difficult to study the intra- and extracellular domains of membrane proteins in liposomes, given that one of those domains is hidden inside the liposome.  A novel technique that removes this barrier was recently developed by Sligar.  He created an amphiphilic protein disc with an opening in the center.  The inner opening is lined with nonpolar residues, while the outer surface of the disc is polar.  When the discs were added to phosphlipids, small bilayers formed inside the disc.  Membrane proteins like the b-2 adrenergic receptor could be reconstituted in the nanodisc bilayers, allowing solvent exposure of both the intracellular and extracellular domains of the receptor protein.

Figure:  Nanodisc with membrane protein

Protein Tertiary Structure

We are getting closer to predicting the tertiary structure of a protein, but as we have seen from molecular mechanics and dynamics calculations, it is a huge computational task.  There are two basic approaches which are often combined.

Many mechanisms of the actual folding process have been postulated, most of which have some experimental support.  In one, a hydrophobic collapse of the protein produces a seed structure upon which secondary structure and final tertiary collapse results.  Alternatively, initial formation of an alpha helix might serve as the seed structure.  A combination of the two is likely.  In one scenario, two small amphiphilic helices might form which interact through their nonpolar faces to produce the initial seed structure.

Many studies have been done on a domain of the protein villin.  A company at Stanford University (Folding at Home) actually allows you to process protein folding data on your own computer when you're not using it (an example of distributed computing).  The example below shows one simulation of length greater than 1 ms.  In the simulation, it collapses to a near native-like state then unfolds again as it iteratively probes conformational space as it "seeks" the global energy minimum.

Zhou and Karplus recently simulated the folding of residues 10-55 of Staphylococcus aureus protein A which form a 3-helix bundle structure.

Figure:   3-helix bundle

Using molecular dynamics, they carried out 100 folding simulations. Two types of folding trajectories were noted.

Figure:  helices form early


Figure:  simultaneous and quick partial helix formation and collapse

The Fersht lab has been combining experimental and theoretical approaches to the folding/unfolding of another three helix bundle protein, Engrailed homeodomain. 

Figure:  Engrailed homeodomain

This protein is among the fastest folding and unfolding proteins known (ms time scale).  This time frame is now also amenable to study through molecular dynamics simulations.  Both sets of data support a folding pathway in which the unfolded state (U) collapses in a microsecond to an intermediate state (I) characterized by significant native secondary structure and mobile side chains that is less compact than the native state (N).  The I state hence resembles the molten globule state.  To more clearly understand the unfolded state, they generated a mutant (Leu16Ala) which was only marginally stable at room temperature (2.5 kcal/mol).  Spectroscopic measurements (CD, NMR) showed this state to resemble the intermediate (I) state, with much native secondary structure and a 33% greater radius of gyration than the N state.  In effect they could study the transient intermediate of the wild type protein more easily by making that state more stable through mutagenesis.  These studies showed that the intermediate is on the folding pathway and not inhibitory to the process.  Using molecular dynamic simulations, the intermediate to native state transition was shown to proceed via a transition state (TS) in which the native secondary structure is almost all present and the helices are engaged in the final packing process.

Figure:  Complete Folding Pathway of Engrailed Homeodomain by Experiment and Simulation

Bradley et al (2005) have taken another step forward in prediction of tertiary structure for small proteins
(< 85 amino acids).  They describe the two biggest stumbling blocks to such predictions as the huge number of conformations which must be explored (i.e. all of conformational space) and accurate determination of the energy of the solvated structures.  Searching conformational space is difficult since the energy landscape around the global energy minimum can be very steep and sharp,  since modest side chain displacements arising from subtle main chain movements cause significant side chain packing and energy changes.  The narrowness of the energy well makes it difficult to find the global minimum in stochastic conformational search processes.  Energy calculations also require better (more realistic) energy functions (force fields) which show the native state to be clearly differentiated as the global minimum from the denatured (non-native) states.  They conducted energy calculations on many different small proteins and produced for each protein a low resolution model. To reach this low resolution model for a given protein, they found many sequence homologs of the given target protein.   These homologs were naturally occurring sequence variants found by a relatively conservative BLAST sequence search, with sequence identities of 30-60 percent.  They also contained insertions and deletions compared to the target sequence, which probably are involved in surface loop structures.   The target and homolog sequences were folded, generating a more diverse population of low-resolution models as starting points for all-atom refinement of the structure.   Then, using a new force field that stressed short range interactions (van der Waals, H-bonding), which would expected to be more important for final folding of the low resolution models than long range electrostatic forces), they were able to refine the models and condense to a final low energy that was very close in main and side chain packing to the experimental crystal structure (resolution < 1. angstroms). 


The holy grail in protein folding research has always been to predict the tertiary structure of a protein given its primary sequence.  A similar but conceptually easier problem is to design a protein which will fold to a given structure with predicted secondary structure.  Many possible sequences could be designed to fold to the desired structure, which makes this problem easier compared to the folding of a given sequence to just one native state.  Kuhlman et al. have recently accomplished such a feat for a synthetic protein of 93 amino acids which they designed to fold to a unique topology not yet observed in nature.  This represents a significant advance over earlier attempts in which mimics of known proteins were made.   Such structures would be expected to fold in analogous fashions to the parent protein because of the necessary constraints placed by the need to fold to a compact state.

Jmol: Top7 - A designed 93 amino acid protein with a novel fold Jmol

Several web sites exist that allow users to download protein folding software onto their own PC.  By distributing folding calculations to many home PC, their untapped computational power can be linked to provide the vast computational time needed to perform these calculations.

Online LiteratureOnline LIterature: 

Recent References

  1. Bradley, P. et al. Toward high-resolution de novo structure prediction for small proteins.  Science. 309, 1868 (2005)
  2. Boyle J. A. Bioinformatics in Undergraduate Education.  Biochemistry and Molecular Biology Education. 32, 236 (2004)
  3. Feig, A. L., & Jabri, E. . Incorporation of Bioinformatics Exercises into the Undergraduate Biochemistry.  Biochemistry and Molecular Biology Education. 30, 224 (2002)
  4. Mayor et al. The complete folding pathway of a protein from nanoseconds to microseconds. Nature 421, pg 863 (2003)
  5. Zhou and Karplus. Interpreting the folding kinetics of helical proteins.  Nature 401, pg 400(1999) 

Navigation